The short version of insulin-like growth factor 1 fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2026-05-17 and is reviewed periodically as new material appears.
Pharmacodynamic studies show that tesamorelin reduces visceral adipose tissue more than subcutaneous adipose tissue in the studied population. This selectivity may relate to differences in blood flow and hormone sensitivity between fat depots. Effects on glucose metabolism and insulin sensitivity have been investigated, with some trials reporting modest changes and others showing stability. The precise relationship between growth hormone exposure, IGF-1 levels, and visceral fat loss remains an active area of analysis.
Tesamorelin binds to growth hormone-releasing hormone receptors on somatotroph cells in the anterior pituitary. Receptor activation increases intracellular cyclic AMP and promotes synthesis and secretion of growth hormone. Because the peptide mimics endogenous GHRH, it amplifies the normal pulsatile release of growth hormone rather than providing exogenous growth hormone directly. This upstream action distinguishes tesamorelin from recombinant growth hormone preparations and from growth hormone secretagogues that act at different receptors.
Assays for these markers differ in calibration and antibody specificity, so results from different platforms are not always interchangeable. Reported values can shift when a laboratory changes method, even without any biological change. Studies that span long periods or multiple sites often need cross-validation of assays. This methodological variability is a recognized limitation when comparing findings across published reports, and it remains a topic of ongoing standardization work.
Measuring the effect of a growth hormone-releasing hormone analogue requires markers that reflect pituitary output rather than the peptide itself. The two most frequently used are growth hormone and insulin-like growth factor 1. Growth hormone fluctuates sharply across the day and responds to sleep, stress, and meals, so isolated readings can be difficult to interpret. Insulin-like growth factor 1 changes more slowly and is often treated as the more stable integrated marker of axis activity.
Because growth hormone is released in pulses, single measurements can misrepresent overall secretion. Investigators sometimes use repeated sampling or overnight profiles to capture the pattern rather than a single value. Provocative testing, in which a stimulus is given and the response is tracked over time, offers another way to characterize the axis. Each approach carries trade-offs between sensitivity, burden on the participant, and the influence of non-target variables.
| Property | Value | Notes |
|---|---|---|
| Primary target | Growth hormone-releasing hormone receptor | Located on anterior pituitary somatotroph cells. |
| Receptor class | G protein-coupled receptor | Activation increases intracellular cyclic AMP. |
| Main downstream hormone | Growth hormone and insulin-like growth factor 1 | Growth hormone release precedes IGF-1 elevation. |
| Primary studied effect | Reduction in visceral adipose tissue | Measured by computed tomography in clinical trials. |
| Approximate half-life | 26–38 minutes after subcutaneous administration | Values vary by assay and study population. |
Quantitation of the peptide relies mainly on reversed-phase high-performance liquid chromatography with ultraviolet detection, typically at 214 nanometers, where the peptide bond absorbs. Identity is confirmed by mass spectrometry, most often electrospray ionization coupled to liquid chromatography, and by peptide mapping after enzymatic digestion. Because related impurities differ only slightly in sequence or modification, method development emphasizes resolution rather than speed. Purity is usually reported as a percentage of the main peak area, with individual impurities listed separately when they exceed a defined reporting threshold.
Stability testing examines how the molecule changes under controlled stress. Thermal stress, light exposure, and extremes of pH are applied separately so that each degradation route can be attributed to a specific cause. The main observed changes are oxidation, deamidation, and aggregation into dimers or higher-order species. Accelerated studies at elevated temperature are used to estimate behavior over longer periods, though such extrapolation carries uncertainty. For a lyophilized powder, residual moisture and the choice of bulking agent strongly influence how quickly these changes appear.
Once reconstituted, the peptide is handled as a solution and is less stable than the lyophilized powder. Aqueous solutions are commonly kept cold and used within a defined period. Buffer composition and pH influence degradation rates, with extremes of acidity or alkalinity accelerating hydrolysis. Preservatives may be added in multi-dose formats to limit microbial growth. Freezing and thawing of solutions is generally avoided because it can cause precipitation or loss of activity.
Identity and purity are assessed by reversed-phase high-performance liquid chromatography, which separates the peptide from related impurities. Mass spectrometry, often coupled to liquid chromatography, confirms molecular mass and detects chemical modifications. Peptide mapping and amino acid analysis can verify sequence integrity. Water content is measured by Karl Fischer titration, and residual solvents may be checked by gas chromatography. These methods together support batch-to-batch consistency and routine quality control.
Lyophilized tesamorelin is generally stored refrigerated at temperatures between 2 and 8 degrees Celsius. The solid form is comparatively stable when kept dry and protected from light. Moisture uptake can promote aggregation and degradation, so sealed containers with desiccant are common. Researchers typically avoid repeated temperature cycling, which may stress the peptide. Documentation accompanying reference materials usually specifies a shelf life under these conditions.
Vernix caseosa, or simply vernix, is the waxy white substance found coating the skin of newborn human babies. It is produced by dedicated cells and is thought to have some protective roles during fetal development and for a few hours after birth.
In 2012, Brenner and Dagmar Ringe developed pre-medical curriculum recommendations that would be consistent with a revised Medical College Admission Test (MCAT), following a request from the President of the American Society for Biochemistry and Molecular Biology, Suzanne Pfeffer. The recommendations, which include development of inorganic, organic and biochemistry coursework that is more geared toward the chemistry of bioorganic functional groups, have been further refined in academic journals. Brenner's contribution to this area was recognized by the 2016 ASBMB Award for Exemplary Contributions to Education.
ALFA-tag, a de novo designed helical peptide tag (SRLEEELRRRLTE) for biochemical and microscopy applications. The tag is recognized by a repertoire of single-domain antibodies AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE) EPEA-tag, commercially called CaptureSelect C-tag, a 4 AA peptide that is recognized by a VHH or single-domain camelid antibody which was discovered through phage display (EPEA) Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL) iCapTag™ (intein Capture Tag), a self-removing peptide-based tag (MIKIATRKYLGKQNVYGIGVERDHNFALKNGFIAHN). The iCapTag™ is controlled by pH change. Typically the pH change occurs from pH 8.5 to pH 6.2 and causes release of tagless target-protein to eluent. If needed the pH shift and buffers can be optimized for protein-specific purification method (e.g., for membrane proteins detergent could be added to the buffers to increase solubility of the protein). In contrast to other protein purification methods, this method is not relaying on proteases to cleave off a tag from tag-protein complex. Instead, during elution phase since buffer pH is changed from 8.5 to pH 6.2 that triggers cleavage reaction resulting in a release of tagless target protein while highly engineered tag stays attached to the column. The expected purity of tagless target proteins or peptides is between 95-99%. The iCapTag™ contains patented component derived from Nostoc punctiforme (Npu) intein.
=== Extant reptiles === The thorny devil (Moloch horridus) is similar in diet and activity patterns to the Texas horned lizard (Phrynosoma cornutum), although the two are not particularly closely related. Amphisbaenian skulls closely resemble those of caecilians and mammals. Modern crocodilians resemble prehistoric phytosaurs, champsosaurs, certain labyrinthodont amphibians, and perhaps even the early whale Ambulocetus. The resemblance between the crocodilians and phytosaurs in particular is quite striking; even to the point of having evolved the graduation between narrow- and broad-snouted forms, due to differences in diet between particular species in both groups. Death adders strongly resemble true vipers, but are elapids. Legless lizards evolved multiple times independently, including snakes, which are also legless lepidosaurs nested among legged lizards. Major examples of unrelated legless lizards include glass lizards (family Anguidae, related to legged alligator lizards) and flap-footed lizards (family Pygopodidae, related to geckos), which each may be mistaken for snakes. Large tegu lizards of South America have converged in form and ecology with monitor lizards, which are not present in the Americas. Anole lizards, with populations on isolated islands, are one of the best examples of both adaptive radiation and convergent evolution. Anoles on a given island evolve into multiple body types and ecological preferences, and the same set of body types appears in unrelated species across distant islands.
Sources: en.wikipedia.org
== Interactions == No interaction studies with this substance have been performed. Interactions with systemic (for example, oral) drugs are considered unlikely because bimatoprost does not reach relevant concentrations in the bloodstream. Bimatoprost does not negatively interact with timolol eye drops.
=== Bioelectricity === The potential use of developmental bioelectricity in regenerative medicine is under active investigation, with particular interest in future organ and limb regeneration guided by bioelectric stimulation. Developmental bioelectricity refers to endogenous ion flows and voltage gradients across cell membranes (Vmem) in excitable (able to create an action potential) and non-excitable tissues that provide instructive cues for growth. These bioelectric states, set by ion channels and pumps, are propagated through gap-junction coupling and together with chemical gradients and physical forces they form long-range patterning circuits. Through voltage-sensitive signalling pathways, changes in Vmem modulate gene expression and cell behaviours (proliferation, migration, differentiation), thereby shaping tissue growth and polarity. Experiments in vertebrate and invertebrate models indicate that bioelectric cues can steer regeneration. In Xenopus tadpoles, activating a proton pump (V-ATPase) that moves hydrogen ions out of cells is necessary for tail regrowth and can restore regeneration during a normally refractory stage; in adult Zebrafish, inhibiting the same pump impairs fin regrowth. In Planarians, brief electrical perturbations can cause tail pieces to form heads (including two-headed animals) or to regenerate heads resembling other species. In adult frogs, a 24-hour treatment with a drug-delivering ‘BioDome’ device initiated long-term hindlimb regrowth with multi-tissue repair and functional recovery.
In February 2010, the German Research Foundation published new guidelines to reduce the number of publications that could be submitted when applying for funding: "The focus has not been on what research someone has done but rather how many papers have been published and where." They noted that for decisions concerning "performance-based funding allocations, postdoctoral qualifications, appointments, or reviewing funding proposals, [where] increasing importance has been given to numerical indicators such as the h-index and the impact factor". The UK's Research Assessment Exercise for 2014 also banned the journal impact factor although evidence suggested that this ban was often ignored. In response to growing concerns over the inappropriate use of journal impact factors in evaluating scientific outputs and scientists themselves, the American Society for Cell Biology together with a group of editors and publishers of scholarly journals created the San Francisco Declaration on Research Assessment (DORA). Released in May 2013, DORA has garnered support from thousands of individuals and hundreds of institutions, including in March 2015 the League of European Research Universities (a consortium of 21 of the most renowned research universities in Europe), who have endorsed the document on the DORA website. Publishers, even those with high impact factors, also recognised the flaws.
Sources: en.wikipedia.org
==== Esterification ==== HA can be reacted with an epoxide such as glycidyl methacrylate and triethylamine in water to form these ester bonds. Alkyl halides, tosylates, and diazomethane can also be used to create ester bonds, but this reaction requires you to convert the native HA sodium salt to its TBA salt, which can be time consuming. These esterification reactions at the carboxyl group usually require a low pH. There are many different types of esterification reactions at both the carboxyl and hydroxyl groups.
A positive diagnosis test for thiamine deficiency involves measuring the activity of the enzyme transketolase in erythrocytes (erythrocyte transketolase activation assay). Alternatively, thiamine and its phosphorylated derivatives can directly be detected in whole blood, tissues, foods, animal feed, and pharmaceutical preparations following the conversion of thiamine to fluorescent thiochrome derivatives (thiochrome assay) and separation by high-performance liquid chromatography. Capillary electrophoresis techniques and in-capillary enzyme reaction methods have emerged as alternative techniques in quantifying and monitoring thiamine levels in samples. The normal thiamine concentration in EDTA-blood is about 20–100 μg/L.
== Research == Dietary BCAAs have been used in an attempt to treat some cases of hepatic encephalopathy. They can have the effect of alleviating symptoms of hepatic encephalopathy, but there is no evidence they benefit mortality rates, nutrition, or overall quality of life as further research is necessary. Certain studies suggested a possible link between a high incidence of amyotrophic lateral sclerosis (ALS) among professional American football players and Italian soccer players, and certain sports supplements including BCAAs. In mouse studies, BCAAs were shown to cause cell hyper-excitability resembling that usually observed in ALS patients. The proposed underlying mechanism is that cell hyper-excitability results in increased calcium absorption by the cell and thus brings about cell death, specifically of neuronal cells which have particularly low calcium buffering capabilities. Yet any link between BCAAs and ALS remains to be fully established. While BCAAs can induce a hyperexcitability similar to the one observed in mice with ALS, current work does not show if a BCAA-enriched diet, given over a prolonged period, actually induces ALS-like symptoms. Blood levels of the BCAAs are elevated in obese, insulin resistant humans and in mouse and rat models of diet-induced diabetes, suggesting the possibility that BCAAs contribute to the pathogenesis of obesity and diabetes. BCAA-restricted diets improve glucose tolerance and promote leanness in normal weight mice, restores insulin sensitivity and normal body weight to obese mice and promotes insulin sensitivity in obese rats.
==== Private expert panel proposals ==== The Peter G. Peterson Foundation solicited proposals from six organizations, which included the American Enterprise Institute, the Bipartisan Policy Center, the Center for American Progress, the Economic Policy Institute, The Heritage Foundation, and the Roosevelt Institute Campus Network. The recommendations of each group were reported in May 2011. A year later, Solutions Initiative II asked five leading think tanks — the American Action Forum, the Bipartisan Policy Center, the Center for American Progress, the Economic Policy Institute, and The Heritage Foundation — to address the near-term fiscal challenges of the "fiscal cliff" while offering updated long-term plans. In 2015, the Peterson Foundation invited the American Action Forum, the American Enterprise Institute, the Bipartisan Policy Center, the Center for American Progress, and the Economic Policy Institute to developed specific, "scorable" policy proposals to set the federal budget on a sustainable, long-term path for prosperity and economic growth. The Bipartisan Policy Center (BPC) sponsored a Debt Reduction Task Force, co-chaired by Pete V. Domenici and Alice M. Rivlin. The Domenici-Rivlin panel created a report called "Restoring America's Future", which was published in November 2010. The plan claimed to stabilize the debt to GDP ratio at 60%, with up to $6 trillion in debt avoidance over the 2011–2020 period.
Sources: en.wikipedia.org
It targets the growth hormone-releasing hormone receptor on pituitary somatotroph cells. Binding stimulates cyclic AMP signaling and growth hormone secretion. This is the same receptor used by endogenous GHRH.
It does not act directly on adipose tissue as a primary mechanism. Instead, it increases endogenous growth hormone, which then influences lipolysis and fat distribution. The reduction in visceral fat is an indirect pharmacodynamic effect.
Tesamorelin acts upstream at the pituitary to amplify natural pulsatile growth hormone release. Growth hormone injections provide exogenous hormone and bypass pituitary regulation. The two approaches therefore differ in feedback control and hormonal dynamics.
It varies slowly and reflects cumulative axis activity rather than momentary secretion. Growth hormone is released in pulses affected by sleep, stress, and meals, making single readings hard to interpret. The slower marker gives a more stable picture across a study period.