Everything below concerns Lipodystrophy. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Last reviewed on 2026-05-11. Where a claim depends on a specific study, the study is described rather than over-claimed.
Tesamorelin occupies a narrow position among agents that act on the growth hormone axis. Unlike growth hormone itself, which is given as replacement, it stimulates the pituitary to release the hormone in pulses, so the downstream increase in insulin-like growth factor 1 depends on intact somatotroph function. Other peptides in the same family include shorter GHRH fragments and synthetic secretagogues with different stability profiles. Several points remain unresolved, including whether the reduction in visceral fat translates into fewer cardiovascular events, what happens to metabolic markers after long-term use, and how the drug compares with lifestyle or surgical approaches.
Tesamorelin is a synthetic peptide that belongs to the growth hormone-releasing hormone family and contains the same forty-four amino acid sequence as endogenous GHRH, extended at the amino terminus by a trans-3-hexenoyl group. That small fatty acid modification protects the peptide from rapid cleavage by dipeptidyl peptidase-4, the enzyme that shortens the half-life of native GHRH to only a few minutes. Chemically the compound is produced by solid-phase peptide synthesis, purified by chromatography, and supplied as a sterile lyophilized powder for reconstitution.
The hexenoyl cap slows the enzyme step that trims the amino terminus of native GHRH, the same step that shortens its active lifetime in circulation. As a result, the modified peptide persists longer in plasma than the unmodified hormone in side-by-side comparison. Receptor activity stays broadly comparable, because the added group sits away from the residues that contact the binding site. This combination, preserved receptor activity with reduced degradation, explains why the analog was developed instead of the native sequence.
Several compounds share the GHRH framework, including sermorelin, the shorter 1-29 fragment, and other analogs built on the full 1-44 chain. Naming follows a common convention: a stem that identifies the peptide plus a suffix marking analog status. Reports may describe tesamorelin by its sequence fragment, as a GHRH(1-44) analog, or by its amino-terminal modification. Indexing the compound therefore requires searching all of these forms, since some older literature predates the current international nonproprietary name.
| Property | Value | Notes |
|---|---|---|
| Peptide class | Synthetic GHRH analogue | 44 residues; N-terminal trans-3-hexenoyl group |
| First approval year | 2010 | United States; HIV-associated abdominal fat accumulation |
| Administration route | Subcutaneous injection | Abdominal site; clinician-administered or self-injected |
| Common synonyms | TH9507; tesamorelin acetate | Development code and acetate salt form |
| Originator | Canadian biotechnology firm | Original developer and regulatory sponsor |
== Phase 1 == The first phase of the Protein Structure Initiative (PSI-1) lasted from June 2000 until September 2005, and had a budget of $270 million funded primarily by NIGMS with support from the National Institute of Allergy and Infectious Diseases. PSI-1 saw the establishment of nine pilot centers focusing on structural genomics studies of a range of organisms, including Arabidopsis thaliana, Caenorhabditis elegans and Mycobacterium tuberculosis. During this five-year period over 1,100 protein structures were determined, over 700 of which were classified as "unique" due to their < 30% sequence similarity with other known protein structures. The primary goal of PSI-1, to develop methods to streamline the structure determination process, resulted in an array of technical advances. Several methods developed during PSI-1 enhanced expression of recombinant proteins in systems like Escherichia coli, Pichia pastoris and insect cell lines. New streamlined approaches to cell cloning, expression and protein purification were also introduced, in which robotics and software platforms were integrated into the protein production pipeline to minimize required manpower, increase speed, and lower costs.
A rotary valve (also called rotary-motion valve) is a type of valve in which the rotation of a passage or passages in a transverse plug regulates the flow of liquid, gas or dry bulk products through the attached pipes. The common stopcock is the simplest form of rotary valve. Rotary valves have been applied in numerous applications, including:
Blue Ridge is an American action-crime television series, based on the film of the same name. The film Blue Ridge aired in 2020, with former Green Beret Justin Wise as the main character. The story continues in the series following Justin's new life in the Blue Ridge Mountains. The first season of the show aired on INSP and Western Bound in spring 2024. It since became available on Amazon Prime Video, along with other streaming platforms. It was renewed for a second season in 2025, and is set to air on INSP beginning in July 2026. It was also made available for streaming on Universal TV earlier in 2026.
Experiments using iTRAQ labeling and LC-MS/MS with STEP and PSP peptide internal standards have successfully quantified total and active protease levels in biological samples. One major drawback for this approach is the inability to account for inhibitor bound enzymes. It is also difficult to ensure standard peptides can be generated for this method for each and every protease for study. However, PSPs hold large potential for translating degradomics into clinical applications, as once a PSP is established it could aid in quantifying proteolytic signature biomarkers in Single Reaction Monitoring (SRM) and Multiple Reaction Monitoring (MRM) type clinical assays.
Sources: en.wikipedia.org
The Atlantic drew parallels between Logan's abusive form of love for his children with the Lear line "Love's not love / when it is mingled with regards that stand / Aloof from th' entire point." The impossibility of Logan's aspirations was likened to that of Lear's by DePaul Law Review, with both figures simultaneously trying to accept their impeding deaths while refusing to abandon their positions in life.
== History == EARS-Net is the collaborative effort of 29 countries. The information documented are antibiotic resistance which are determined according to the EUCAST standard. Around 80% of the participants utilize the EUCAST standard for detection of antibiotic resistance. EARS-Net was established in 1998 as EARSS, funded by the European Commission's Directorate General for Health and Consumer Affairs and the Dutch Ministry of Health, Welfare and Sports. However, in January 2010, it was transferred to the European Centre for Disease Prevention and Control (ECDC) where it was renamed EARS-Net.
The ambient temperature 1H NMR spectrum shows two methyl signals, indicative of hindered rotation about the (O)C−N bond. At temperatures near 100 °C, the 500 MHz NMR spectrum of this compound shows only one signal for the methyl groups. DMF is miscible with water. The vapour pressure at 20 °C is 3.5 hPa. A Henry's law constant of 7.47 × 10−5 hPa·m3/mol can be deduced from an experimentally determined equilibrium constant at 25 °C. The partition coefficient log POW is measured to −0.85. Since the density of DMF (0.95 g·cm−3 at 20 °C) is similar to that of water, significant flotation or stratification in surface waters in case of accidental losses is not expected.
7-OH-MIT, like mitragynine, appears to be a mixed opioid receptor agonist/antagonist, with recent research indicating that it acts as a partial agonist at μ-opioid receptors and as a competitive antagonist at δ- and κ-opioid receptors. Both 7-OH-MIT and mitragynine do not appear to activate the β-arrestin pathway, distinguishing it from traditional opiate and opioid chemicals. Cross-tolerance to morphine was evident in mice rendered tolerant to 7-OH-MIT and vice versa. Naloxone-induced withdrawal signs were elicited equally in mice consistently dosed with 7-OH-MIT or morphine.
Durability of the effect of mitomycin gel in subjects with a complete response was also evaluated using urine cytology, ureteroscopy and biopsy (if warranted) every three months for a year following the initiation of therapy. Nineteen subjects (46%) who achieved a complete response continued to have a complete response at the twelve-month mark. The US Food and Drug Administration (FDA) granted the application for mitomycin gel priority review along with breakthrough therapy, fast track, and orphan drug designations. The FDA granted approval of Jelmyto to UroGen Pharma, Inc. The efficacy of mitomycin C for the treatment of recurrent low-grade intermediate-risk non-muscle invasive bladder cancer was evaluated in ENVISION (NCT05243550), a single-arm, multi-center trial in 240 adults with low-grade non-muscle invasive bladder cancer that recurred after prior transurethral resection of bladder tumor and met 1-2 of the following criteria: multiple tumors, a solitary tumor >3 cm, and/or recurrence within one year. Participants received 75 mg mitomycin intravesical solution instilled once a week for six consecutive weeks. Assessment of tumor status was performed every three months by cystoscopy, for-cause biopsy, and urine cytology.
Sources: en.wikipedia.org
It is established that the use of antibiotics in animal husbandry can give rise to AMR resistances in bacteria found in food animals to the antibiotics being administered (through injections or medicated feeds). For this reason only antimicrobials that are deemed "not-clinically relevant" are used in these practices. Unlike resistance to antibacterials, antifungal resistance can be driven by arable farming, currently there is no regulation on the use of similar antifungal classes in agriculture and the clinic. Recent studies have shown that the prophylactic use of "non-priority" or "non-clinically relevant" antimicrobials in feeds can potentially, under certain conditions, lead to co-selection of environmental AMR bacteria with resistance to medically important antibiotics. The possibility for co-selection of AMR resistances in the food chain pipeline may have far-reaching implications for human health.
== Melanization process == Active PO plays an important role in the initial stages of the melanization process. The PO catalyses a hydroxylation of monophenols (tyrosine) on diphenols and oxidation of diphenols to dichinones. The chinones non-enzymatically change their structure to dopachrome and then dopachrome isomerase changes dopachrome to indole. In the final phase of the process melanin is made by an oxidation and a polymerization. Melanin is rapidly deposited around the pathogen, thereby limiting its ability to damage the host organism. Storage of melanin at the site of damage also prevents further loss of hemolymph. Long-term or overproduce of substances arising during a PO cascade can lead to tissue damage and cell death at the site of the reaction. For this reason, these reactions are strictly regulated.
It was thought appropriate to choose a name to dissociate nicotinic acid from nicotine, to avoid the perception that vitamins or niacin-rich foods contain nicotine, or that cigarettes contain vitamins. The resulting name niacin was derived from nicotinic acid + vitamin. J. Laguna and K.J. Carpenter found in 1951, that niacin in corn is biologically unavailable and can be released only in very alkaline lime water of pH 11. This explains why a Latin-American culture that used alkali-treated (nixtamalized) cornmeal to make tortilla was not at risk for niacin deficiency. The modern explanation is that alkali treatment enhances the bioavailability of tryptophan, not directly any form of niacin.
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
Sources: en.wikipedia.org
It is a laboratory-made peptide of forty-four amino acids whose sequence matches human growth hormone-releasing hormone, with a modified amino terminus. The modification is a short unsaturated fatty acid chain attached to the first residue. This change slows enzymatic breakdown and lengthens the time the peptide stays active in circulation.
The clinical program was designed around HIV-associated lipodystrophy, a condition in which fat accumulates abnormally around the internal organs. Trials enrolled that specific population, so the evidence base covers it rather than the general population. Regulators approved the drug for the studied indication only, and promotion outside it is not permitted.
Growth hormone therapy supplies the finished hormone directly, while this peptide acts upstream and asks the pituitary to secrete its own. That difference means the response depends on a functioning pituitary and on the body's normal feedback loops. It also means the circulating hormone profile is pulsatile rather than a flat, injected level.
No. It is a peptide that acts upstream of growth hormone release, while growth hormone is the hormone itself. The two differ in size, in receptor, and in how the body clears them.